sanitarynapkinvendingmachine.com

✓ Verified Publisher

Explore backlink opportunities, domain metrics, and guest posting specifications for sanitarynapkinvendingmachine.com.

Domain Authority & Link Metrics

1
Domain Authority (DA)
6
Page Authority (PA)
65%
Spam Score (SS)
Link Attribute Do Follow
Opportunity Type Guest Post
Primary Industry Niche General / Multitopic
Traffic Region

Link Building & Niche Profile for sanitarynapkinvendingmachine.com

Grade: C (Standard)

sanitarynapkinvendingmachine.com features a Domain Authority of 1, Page Authority of 6, and a low Spam Score of 65%. Acquiring contextual backlinks from verified publishers in the General / Multitopic category helps build organic domain authority in .

📋 Editorial & Placement Guidelines
  • Ensure content matches audience expectations in the General / Multitopic industry.
  • Use natural anchor text distribution for Do Follow link placements.
  • Metrics last verified: September 2026.
🛡️ Google Search Central — Disavow & Risk Safety Guidance

Google's automated spam algorithms automatically neutralize low-quality or unnatural web links. Google recommends reserving the Disavow tool for severe manual penalties or documented spam attacks. Perform manual editorial reviews before submitting disavow files to Google Search Console.

ℹ️ Data Quality & Metric Verification Disclosure

Publisher metrics (DA, PA, Spam Score) are compiled periodically using third-party crawler data feeds and updated monthly. Always perform independent editorial due diligence regarding target audience alignment and publishing requirements before initiating outreach.

📊

Track Backlink Changes Automatically

Keep track of active backlinks 24/7. Get instant email alerts if a link turns into a 404, drops, or changes to nofollow.

Start Free Backlink Monitoring →